PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_09901.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 337aa    MW: 37840.1 Da    PI: 6.7812
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_09901.1_g00001.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.61.9e-153279148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g W+++Ede+l+++    G g+W+ Iar  g+ R++k+c++rw +yl
  Rsa1.0_09901.1_g00001.1 32 KGLWSPDEDERLIRYMLTNGQGCWSDIARNAGLLRCGKSCRLRWINYL 79
                             678*****************************99************97 PP

2Myb_DNA-binding50.25.9e-1685129147
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              rg+++++E++l+++++  lG++ W+ Ia +++ gRt++++k++w++ 
  Rsa1.0_09901.1_g00001.1  85 RGSFSPQEEDLIIHLHSILGNR-WSQIATRLP-GRTDNEIKNFWNST 129
                              899*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.4312779IPR017930Myb domain
SuperFamilySSF466897.42E-2829126IPR009057Homeodomain-like
SMARTSM007174.1E-123181IPR001005SANT/Myb domain
PfamPF002497.0E-143279IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.3E-223386IPR009057Homeodomain-like
CDDcd001675.19E-103579No hitNo description
PROSITE profilePS5129424.46480134IPR017930Myb domain
SMARTSM007175.2E-1684132IPR001005SANT/Myb domain
PfamPF002498.4E-1585129IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-2587133IPR009057Homeodomain-like
CDDcd001672.05E-1187130No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MMMRNPNNTT TRDKNKPNHA CGGSNNKPKL RKGLWSPDED ERLIRYMLTN GQGCWSDIAR  60
NAGLLRCGKS CRLRWINYLR PDLKRGSFSP QEEDLIIHLH SILGNRWSQI ATRLPGRTDN  120
EIKNFWNSTL KKRFKNNNNT SSGSSPNNSN SNSLDPRDQH VDIGGKSNPM MDGYHHHDDT  180
MIMRNTMRTD PSSFNFAPMV SGVGLNNLDP LISVPDHNQY QQMGNTGNVF TGLGDYGNAI  240
IDPISKGASV ENEWFLTPSV NGNAIACTTS NNLNVEVLDP CFINSKTMCH SESFKVGNMF  300
SMENASWETE NPKTGDWDLD GLIDNNSSFP FLDFQVD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-282813423128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009135021.10.0PREDICTED: transcription factor TT2-like
RefseqXP_013740976.10.0PREDICTED: transcription factor TT2-like
TrEMBLA0A078CGD00.0A0A078CGD0_BRANA; BnaA03g30340D protein
TrEMBLM4CAQ50.0M4CAQ5_BRARP; Uncharacterized protein
STRINGBra001284.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM70772642
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G08500.10.0myb domain protein 83